SCOPe 2.01: Domain d1oo9b_: 1oo9 B:

Lineage for d1oo9b_ (1oo9 B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.3: TIMP-like [50242] (3 families)

5. Family b.40.3.1: Tissue inhibitor of metalloproteinases, TIMP [50243] (3 proteins)
   contains an irregular alpha+beta subdomain in the C-terminal extension

6. Protein TIMP-1 [50244] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50245] (4 PDB entries)

8. Domain d1oo9b_: 1oo9 B: [87191]
   Other proteins in same PDB: d1oo9a_

Details for d1oo9b_

PDB Entry: 1oo9

PDB Description: orientation in solution of mmp-3 catalytic domain and n-timp-1 from residual dipolar couplings

PDB Compounds: (B:) Metalloproteinase inhibitor 1

SCOPe Domain Sequences for d1oo9b_:

Sequence; same for both SEQRES and ATOM records:

>d1oo9b_ b.40.3.1 (B:) TIMP-1 {Human (Homo sapiens) [TaxId: 9606]}
ctcvpphpqtafcnsdlvirakfvgtpevnqttlyqryeikmtkmykgfqalgdaadirf
vytpamesvcgyfhrshnrseefliagklqdgllhittcsfvapwnslslaqrrgftkty
tvgcee

Timeline for d1oo9b_:

• d1oo9b_ first appeared in SCOP 1.65
  
• d1oo9b_ appears in SCOP 1.75
  
• d1oo9b_ appears in SCOPe 2.02
  
• d1oo9b_ appears in the current release, SCOPe 2.08