Lineage for d1oo9b_ (1oo9 B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2381452Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2382696Superfamily b.40.3: TIMP-like [50242] (4 families) (S)
  5. 2382697Family b.40.3.1: Tissue inhibitor of metalloproteinases, TIMP [50243] (2 protein domains)
    contains an irregular alpha+beta subdomain in the C-terminal extension
    automatically mapped to Pfam PF00965
  6. 2382698Protein TIMP-1 [50244] (1 species)
  7. 2382699Species Human (Homo sapiens) [TaxId:9606] [50245] (6 PDB entries)
  8. 2382708Domain d1oo9b_: 1oo9 B: [87191]
    Other proteins in same PDB: d1oo9a_

Details for d1oo9b_

PDB Entry: 1oo9 (more details)

PDB Description: Orientation in Solution of MMP-3 Catalytic Domain and N-TIMP-1 from Residual Dipolar Couplings
PDB Compounds: (B:) Metalloproteinase inhibitor 1

SCOPe Domain Sequences for d1oo9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oo9b_ b.40.3.1 (B:) TIMP-1 {Human (Homo sapiens) [TaxId: 9606]}
ctcvpphpqtafcnsdlvirakfvgtpevnqttlyqryeikmtkmykgfqalgdaadirf
vytpamesvcgyfhrshnrseefliagklqdgllhittcsfvapwnslslaqrrgftkty
tvgcee

SCOPe Domain Coordinates for d1oo9b_:

Click to download the PDB-style file with coordinates for d1oo9b_.
(The format of our PDB-style files is described here.)

Timeline for d1oo9b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1oo9a_