Lineage for d1oo9a_ (1oo9 A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 867614Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 867615Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (17 families) (S)
  5. 867875Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins)
  6. 868041Protein Stromelysin-1 (MMP-3) [55536] (1 species)
  7. 868042Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (35 PDB entries)
  8. 868092Domain d1oo9a_: 1oo9 A: [87190]
    Other proteins in same PDB: d1oo9b_

Details for d1oo9a_

PDB Entry: 1oo9 (more details)

PDB Description: orientation in solution of mmp-3 catalytic domain and n-timp-1 from residual dipolar couplings
PDB Compounds: (A:) stromelysin-1

SCOP Domain Sequences for d1oo9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oo9a_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]}
frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygppp

SCOP Domain Coordinates for d1oo9a_:

Click to download the PDB-style file with coordinates for d1oo9a_.
(The format of our PDB-style files is described here.)

Timeline for d1oo9a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1oo9b_