SCOP 1.71: Domain d1oo9a_: 1oo9 A:

Lineage for d1oo9a_ (1oo9 A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins)

6. Protein Stromelysin-1 (MMP-3) [55536] (1 species)

7. Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (31 PDB entries)

8. Domain d1oo9a_: 1oo9 A: [87190]
   Other proteins in same PDB: d1oo9b_

Details for d1oo9a_

PDB Entry: 1oo9

PDB Description: orientation in solution of mmp-3 catalytic domain and n-timp-1 from residual dipolar couplings

SCOP Domain Sequences for d1oo9a_:

Sequence; same for both SEQRES and ATOM records:

>d1oo9a_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast}
frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygppp

Timeline for d1oo9a_:

• d1oo9a_ first appeared in SCOP 1.65
  
• d1oo9a_ appears in SCOP 1.69
  
• d1oo9a_ appears in SCOP 1.73
  
• d1oo9a_ appears in the current release, SCOPe 2.08