Lineage for d1oo0b_ (1oo0 B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1908438Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1908439Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1908703Protein RNA-binding protein 8 [89938] (2 species)
  7. 1908704Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [89939] (3 PDB entries)
    CG8781 protein
  8. 1908705Domain d1oo0b_: 1oo0 B: [87183]
    Other proteins in same PDB: d1oo0a_
    protein/RNA complex; complexed with bme, gol, mpd, sr

Details for d1oo0b_

PDB Entry: 1oo0 (more details), 1.85 Å

PDB Description: Crystal structure of the Drosophila Mago nashi-Y14 complex
PDB Compounds: (B:) cg8781-pa

SCOPe Domain Sequences for d1oo0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oo0b_ d.58.7.1 (B:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
pgpqrsvegwilfvtsiheeaqedeiqekfcdygeiknihlnldrrtgfskgyalveyet
hkqalaakealngaeimgqtiqvdwcfvkgpk

SCOPe Domain Coordinates for d1oo0b_:

Click to download the PDB-style file with coordinates for d1oo0b_.
(The format of our PDB-style files is described here.)

Timeline for d1oo0b_: