| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) ![]() |
| Family d.58.7.1: Canonical RBD [54929] (68 proteins) |
| Protein RNA-binding protein 8 [89938] (2 species) |
| Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [89939] (3 PDB entries) CG8781 protein |
| Domain d1oo0b_: 1oo0 B: [87183] Other proteins in same PDB: d1oo0a_ protein/RNA complex; complexed with bme, gol, mpd, sr |
PDB Entry: 1oo0 (more details), 1.85 Å
SCOPe Domain Sequences for d1oo0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oo0b_ d.58.7.1 (B:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
pgpqrsvegwilfvtsiheeaqedeiqekfcdygeiknihlnldrrtgfskgyalveyet
hkqalaakealngaeimgqtiqvdwcfvkgpk
Timeline for d1oo0b_: