![]() | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (48 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) ![]() |
![]() | Family d.58.7.1: Canonical RBD [54929] (20 proteins) |
![]() | Protein RNA-binding protein 8 [89938] (2 species) |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [89939] (3 PDB entries) CG8781 protein |
![]() | Domain d1oo0b_: 1oo0 B: [87183] Other proteins in same PDB: d1oo0a_ complexed with bme, gol, mpd, sr |
PDB Entry: 1oo0 (more details), 1.85 Å
SCOP Domain Sequences for d1oo0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oo0b_ d.58.7.1 (B:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster)} pgpqrsvegwilfvtsiheeaqedeiqekfcdygeiknihlnldrrtgfskgyalveyet hkqalaakealngaeimgqtiqvdwcfvkgpk
Timeline for d1oo0b_: