![]() | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
![]() | Fold d.232: Mago nashi protein [89816] (1 superfamily) beta(4)-alpha-beta(2)-alpha; 2 layers: alpha/beta; antiparallel beta-sheet, order: 651234 |
![]() | Superfamily d.232.1: Mago nashi protein [89817] (1 family) ![]() |
![]() | Family d.232.1.1: Mago nashi protein [89818] (1 protein) |
![]() | Protein Mago nashi protein [89819] (2 species) |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [89820] (3 PDB entries) |
![]() | Domain d1oo0a_: 1oo0 A: [87182] Other proteins in same PDB: d1oo0b_ complexed with bme, gol, mpd, sr |
PDB Entry: 1oo0 (more details), 1.85 Å
SCOP Domain Sequences for d1oo0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oo0a_ d.232.1.1 (A:) Mago nashi protein {Fruit fly (Drosophila melanogaster)} edfylryyvghkgkfgheflefefrpdgklryannsnykndtmirkeafvhqsvmeelkr iiidseimqeddlpwpppdrvgrqeleivigdehisfttsktgslvdvnrskdpeglrcf yylvqdlkclvfsliglhfkikpi
Timeline for d1oo0a_: