Class b: All beta proteins [48724] (176 folds) |
Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily) pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns |
Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) this domain is interrupted by the catalytic beta/alpha barrel domain |
Family b.92.1.7: Isoaspartyl dipeptidase [89438] (1 protein) |
Protein Isoaspartyl dipeptidase [89439] (1 species) |
Species Escherichia coli [TaxId:562] [89440] (5 PDB entries) Uniprot P39377 |
Domain d1onxb1: 1onx B:1-62,B:347-389 [87178] Other proteins in same PDB: d1onxa2, d1onxb2 complexed with asp, zn |
PDB Entry: 1onx (more details), 2.1 Å
SCOPe Domain Sequences for d1onxb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1onxb1 b.92.1.7 (B:1-62,B:347-389) Isoaspartyl dipeptidase {Escherichia coli [TaxId: 562]} midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil cpXeilpgndadllvmtpelrieqvyargklmvkdgkacvkgtfet
Timeline for d1onxb1: