Lineage for d1onxb1 (1onx B:1-62,B:347-389)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2819141Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 2819142Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 2819320Family b.92.1.7: Isoaspartyl dipeptidase [89438] (1 protein)
  6. 2819321Protein Isoaspartyl dipeptidase [89439] (1 species)
  7. 2819322Species Escherichia coli [TaxId:562] [89440] (5 PDB entries)
    Uniprot P39377
  8. 2819328Domain d1onxb1: 1onx B:1-62,B:347-389 [87178]
    Other proteins in same PDB: d1onxa2, d1onxb2
    complexed with asp, zn

Details for d1onxb1

PDB Entry: 1onx (more details), 2.1 Å

PDB Description: crystal structure of isoaspartyl dipeptidase from escherichia coli complexed with aspartate
PDB Compounds: (B:) Isoaspartyl dipeptidase

SCOPe Domain Sequences for d1onxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1onxb1 b.92.1.7 (B:1-62,B:347-389) Isoaspartyl dipeptidase {Escherichia coli [TaxId: 562]}
midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil
cpXeilpgndadllvmtpelrieqvyargklmvkdgkacvkgtfet

SCOPe Domain Coordinates for d1onxb1:

Click to download the PDB-style file with coordinates for d1onxb1.
(The format of our PDB-style files is described here.)

Timeline for d1onxb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1onxb2