SCOP 1.69: Domain d1onxa1: 1onx A:1-62,A:347-389

Lineage for d1onxa1 (1onx A:1-62,A:347-389)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
   pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns

4. Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (7 families)
   this domain is interrupted by the catalytic beta/alpha barrel domain

5. Family b.92.1.7: Isoaspartyl dipeptidase [89438] (1 protein)

6. Protein Isoaspartyl dipeptidase [89439] (1 species)

7. Species Escherichia coli [TaxId:562] [89440] (5 PDB entries)

8. Domain d1onxa1: 1onx A:1-62,A:347-389 [87176]
   Other proteins in same PDB: d1onxa2, d1onxb2

Details for d1onxa1

PDB Entry: 1onx, 2.1 Å

PDB Description: crystal structure of isoaspartyl dipeptidase from escherichia coli complexed with aspartate

SCOP Domain Sequences for d1onxa1:

Sequence; same for both SEQRES and ATOM records:

>d1onxa1 b.92.1.7 (A:1-62,A:347-389) Isoaspartyl dipeptidase {Escherichia coli}
midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil
cpXeilpgndadllvmtpelrieqvyargklmvkdgkacvkgtfet

Timeline for d1onxa1:

• d1onxa1 first appeared in SCOP 1.65
  
• d1onxa1 appears in SCOP 1.67
  
• d1onxa1 appears in SCOP 1.71
  
• d1onxa1 appears in the current release, SCOPe 2.08