Lineage for d1onxa1 (1onx A:1-62,A:347-389)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 304009Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 304010Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (7 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 304102Family b.92.1.7: Isoaspartyl dipeptidase [89438] (1 protein)
  6. 304103Protein Isoaspartyl dipeptidase [89439] (1 species)
  7. 304104Species Escherichia coli [TaxId:562] [89440] (2 PDB entries)
  8. 304107Domain d1onxa1: 1onx A:1-62,A:347-389 [87176]
    Other proteins in same PDB: d1onxa2, d1onxb2

Details for d1onxa1

PDB Entry: 1onx (more details), 2.1 Å

PDB Description: crystal structure of isoaspartyl dipeptidase from escherichia coli complexed with aspartate

SCOP Domain Sequences for d1onxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1onxa1 b.92.1.7 (A:1-62,A:347-389) Isoaspartyl dipeptidase {Escherichia coli}
midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil
cpXeilpgndadllvmtpelrieqvyargklmvkdgkacvkgtfet

SCOP Domain Coordinates for d1onxa1:

Click to download the PDB-style file with coordinates for d1onxa1.
(The format of our PDB-style files is described here.)

Timeline for d1onxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1onxa2