SCOPe 2.06: Domain d1onwa1: 1onw A:1-62,A:347-389

Lineage for d1onwa1 (1onw A:1-62,A:347-389)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
   pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns

4. Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families)
   this domain is interrupted by the catalytic beta/alpha barrel domain

5. Family b.92.1.7: Isoaspartyl dipeptidase [89438] (1 protein)

6. Protein Isoaspartyl dipeptidase [89439] (1 species)

7. Species Escherichia coli [TaxId:562] [89440] (5 PDB entries)
   Uniprot P39377

8. Domain d1onwa1: 1onw A:1-62,A:347-389 [87172]
   Other proteins in same PDB: d1onwa2, d1onwb2
   complexed with cl, edo, mg, na, zn

Details for d1onwa1

PDB Entry: 1onw, 1.65 Å

PDB Description: crystal structure of isoaspartyl dipeptidase from e. coli

PDB Compounds: (A:) Isoaspartyl dipeptidase

SCOPe Domain Sequences for d1onwa1:

Sequence; same for both SEQRES and ATOM records:

>d1onwa1 b.92.1.7 (A:1-62,A:347-389) Isoaspartyl dipeptidase {Escherichia coli [TaxId: 562]}
midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil
cpXeilpgndadllvmtpelrieqvyargklmvkdgkacvkgtfet

Timeline for d1onwa1:

• d1onwa1 first appeared in SCOP 1.65
  
• d1onwa1 appears in SCOPe 2.05
  
• d1onwa1 appears in SCOPe 2.07
  
• d1onwa1 appears in the current release, SCOPe 2.08