SCOPe 2.05: Domain d1onva_: 1onv A:

Lineage for d1onva_ (1onv A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.30: C-terminal domain of the rap74 subunit of TFIIF [63480] (1 protein)
   automatically mapped to Pfam PF05793

6. Protein C-terminal domain of the rap74 subunit of TFIIF [63481] (1 species)
   peptide-recognition motif

7. Species Human (Homo sapiens) [TaxId:9606] [63482] (4 PDB entries)

8. Domain d1onva_: 1onv A: [87171]
   complexed with Fcp1 C-terminal peptide, chain B
   protein/RNA complex

Details for d1onva_

PDB Entry: 1onv

PDB Description: nmr structure of a complex containing the tfiif subunit rap74 and the rnap ii ctd phosphatase fcp1

PDB Compounds: (A:) transcription initiation factor iif, alpha subunit

SCOPe Domain Sequences for d1onva_:

Sequence; same for both SEQRES and ATOM records:

>d1onva_ a.4.5.30 (A:) C-terminal domain of the rap74 subunit of TFIIF {Human (Homo sapiens) [TaxId: 9606]}
dvqvtedavrryltrkpmttkdllkkfqtkktglsseqtvnvlaqilkrlnperkmindk
mhfslke

Timeline for d1onva_:

• d1onva_ first appeared in SCOP 1.65
  
• d1onva_ appears in SCOPe 2.04
  
• d1onva_ appears in SCOPe 2.06
  
• d1onva_ appears in the current release, SCOPe 2.08