Lineage for d1onpb2 (1onp B:1-125,B:275-300)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 476939Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 476940Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 477749Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (17 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 477750Protein 1-deoxy-D-xylulose-5-phosphate reductoisomerase [69410] (2 species)
  7. 477751Species Escherichia coli [TaxId:562] [69411] (10 PDB entries)
  8. 477771Domain d1onpb2: 1onp B:1-125,B:275-300 [87169]
    Other proteins in same PDB: d1onpa1, d1onpa3, d1onpb1, d1onpb3

Details for d1onpb2

PDB Entry: 1onp (more details), 2.5 Å

PDB Description: IspC complex with Mn2+ and fosmidomycin

SCOP Domain Sequences for d1onpb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1onpb2 c.2.1.3 (B:1-125,B:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli}
mkqltilgstgsigcstldvvrhnpehfrvvalvagknvtrmveqclefspryavmddea
sakllktmlqqqgsrtevlsgqqaacdmaaledvdqvmaaivgaagllptlaairagkti
llankXdmrtpiahtmawpnrvnsgvkpldfc

SCOP Domain Coordinates for d1onpb2:

Click to download the PDB-style file with coordinates for d1onpb2.
(The format of our PDB-style files is described here.)

Timeline for d1onpb2: