Lineage for d1onpb1 (1onp B:301-397)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 357519Fold a.69: Left-handed superhelix [47916] (3 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 357606Superfamily a.69.3: 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain [69055] (1 family) (S)
  5. 357607Family a.69.3.1: 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain [69056] (1 protein)
  6. 357608Protein 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain [69057] (1 species)
  7. 357609Species Escherichia coli [TaxId:562] [69058] (5 PDB entries)
  8. 357618Domain d1onpb1: 1onp B:301-397 [87168]
    Other proteins in same PDB: d1onpa2, d1onpa3, d1onpb2, d1onpb3
    complexed with fom, mw1

Details for d1onpb1

PDB Entry: 1onp (more details), 2.5 Å

PDB Description: IspC complex with Mn2+ and fosmidomycin

SCOP Domain Sequences for d1onpb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1onpb1 a.69.3.1 (B:301-397) 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain {Escherichia coli}
klsaltfaapdydrypclklameafeqgqaattalnaaneitvaaflaqqirftdiaaln
lsvlekmdmrepqcvddvlsvdanarevarkevmrla

SCOP Domain Coordinates for d1onpb1:

Click to download the PDB-style file with coordinates for d1onpb1.
(The format of our PDB-style files is described here.)

Timeline for d1onpb1: