Lineage for d1onpb1 (1onp B:301-397)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. Superfamily a.69.3: 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain [69055] (1 family) (S)
  5. Family a.69.3.1: 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain [69056] (1 protein)
  6. Protein 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain [69057] (2 species)
  7. Species Escherichia coli [TaxId:562] [69058] (11 PDB entries)
    Uniprot P45568
  8. Domain d1onpb1: 1onp B:301-397 [87168]
    Other proteins in same PDB: d1onpa2, d1onpa3, d1onpb2, d1onpb3
    complexed with fom, mn

Details for d1onpb1

PDB Entry: 1onp (more details), 2.5 Å

PDB Description: IspC complex with Mn2+ and fosmidomycin
PDB Compounds: (B:) 1-deoxy-D-xylulose 5-phosphate reductoisomerase

SCOPe Domain Sequences for d1onpb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1onpb1 a.69.3.1 (B:301-397) 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain {Escherichia coli [TaxId: 562]}
klsaltfaapdydrypclklameafeqgqaattalnaaneitvaaflaqqirftdiaaln
lsvlekmdmrepqcvddvlsvdanarevarkevmrla

SCOPe Domain Coordinates for d1onpb1 are not available.

Timeline for d1onpb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1onpb2, d1onpb3
View in 3D
Domains from other chains:
(mouse over for more information)
d1onpa1, d1onpa2, d1onpa3