Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) core: beta(3,4)-alpha(3); alpha+beta sandwich |
Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) both first two domains are of same beta/beta/alpha fold |
Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (10 proteins) |
Protein Glutathione reductase [55426] (3 species) |
Species Plasmodium falciparum [89990] (1 PDB entry) |
Domain d1onfa3: 1onf A:377-495 [87143] Other proteins in same PDB: d1onfa1, d1onfa2 |
PDB Entry: 1onf (more details), 2.6 Å
SCOP Domain Sequences for d1onfa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1onfa3 d.87.1.1 (A:377-495) Glutathione reductase {Plasmodium falciparum} ykliptvifshppigtiglseeaaiqiygkenvkiyeskftnlffsvydiepelkektyl klvcvgkdelikglhiiglnadeivqgfavalkmnatkkdfdetipihptaaeefltlq
Timeline for d1onfa3: