Lineage for d1onfa3 (1onf A:377-495)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 507534Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 507535Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
    both first two domains are of same beta/beta/alpha fold
  5. 507536Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (10 proteins)
  6. 507570Protein Glutathione reductase [55426] (3 species)
  7. 507598Species Plasmodium falciparum [89990] (1 PDB entry)
  8. 507599Domain d1onfa3: 1onf A:377-495 [87143]
    Other proteins in same PDB: d1onfa1, d1onfa2

Details for d1onfa3

PDB Entry: 1onf (more details), 2.6 Å

PDB Description: Crystal structure of Plasmodium falciparum Glutathione reductase

SCOP Domain Sequences for d1onfa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1onfa3 d.87.1.1 (A:377-495) Glutathione reductase {Plasmodium falciparum}
ykliptvifshppigtiglseeaaiqiygkenvkiyeskftnlffsvydiepelkektyl
klvcvgkdelikglhiiglnadeivqgfavalkmnatkkdfdetipihptaaeefltlq

SCOP Domain Coordinates for d1onfa3:

Click to download the PDB-style file with coordinates for d1onfa3.
(The format of our PDB-style files is described here.)

Timeline for d1onfa3: