Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.2: Large subunit [58124] (3 proteins) |
Protein Prokaryotic (50S subunit) [58125] (3 species) |
Species Deinococcus radiodurans [TaxId:1299] [69993] (12 PDB entries) |
Domain d1ondz_: 1ond Z: [87140] complexed with troleandomycin macrolide antibiotic protein/RNA complex; complexed with tao |
PDB Entry: 1ond (more details), 3.4 Å
SCOPe Domain Sequences for d1ondz_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ondz_ i.1.1.2 (Z:) Prokaryotic (50S subunit) {Deinococcus radiodurans [TaxId: 1299]} akhpvpkkktskskrdmrrshhaltapnltecpqchgkklshhicpncgyydgrqvla
Timeline for d1ondz_: