Lineage for d1ondz_ (1ond Z:)

  1. Root: SCOPe 2.05
  2. 1970697Class i: Low resolution protein structures [58117] (25 folds)
  3. 1970698Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1970699Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1971716Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 1971851Protein Prokaryotic (50S subunit) [58125] (3 species)
  7. 1971852Species Deinococcus radiodurans [TaxId:1299] [69993] (12 PDB entries)
  8. 1971920Domain d1ondz_: 1ond Z: [87140]
    complexed with troleandomycin macrolide antibiotic
    protein/RNA complex; complexed with tao

Details for d1ondz_

PDB Entry: 1ond (more details), 3.4 Å

PDB Description: the crystal structure of the 50s large ribosomal subunit from deinococcus radiodurans complexed with troleandomycin macrolide antibiotic
PDB Compounds: (Z:) 50S ribosomal protein L32

SCOPe Domain Sequences for d1ondz_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ondz_ i.1.1.2 (Z:) Prokaryotic (50S subunit) {Deinococcus radiodurans [TaxId: 1299]}
akhpvpkkktskskrdmrrshhaltapnltecpqchgkklshhicpncgyydgrqvla

SCOPe Domain Coordinates for d1ondz_:

Click to download the PDB-style file with coordinates for d1ondz_.
(The format of our PDB-style files is described here.)

Timeline for d1ondz_: