SCOP 1.67: Domain d1ondz_: 1ond Z:

Lineage for d1ondz_ (1ond Z:)

1. Root: SCOP 1.67

2. Class i: Low resolution protein structures [58117] (22 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.2: Large subunit [58124] (3 proteins)

6. Protein 50S subunit [58125] (3 species)

7. Species Deinococcus radiodurans [TaxId:1299] [69993] (14 PDB entries)

8. Domain d1ondz_: 1ond Z: [87140]
   complexed with troleandomycin macrolide antibiotic

Details for d1ondz_

PDB Entry: 1ond, 3.4 Å

PDB Description: the crystal structure of the 50s large ribosomal subunit from deinococcus radiodurans complexed with troleandomycin macrolide antibiotic

SCOP Domain Sequences for d1ondz_:

Sequence; same for both SEQRES and ATOM records:

>d1ondz_ i.1.1.2 (Z:) 50S subunit {Deinococcus radiodurans}
akhpvpkkktskskrdmrrshhaltapnltecpqchgkklshhicpncgyydgrqvla

Timeline for d1ondz_:

• d1ondz_ first appeared in SCOP 1.65
  
• d1ondz_ appears in SCOP 1.69
  
• d1ondz_ appears in the current release, SCOPe 2.08