Lineage for d1ondz_ (1ond Z:)

  1. Root: SCOP 1.65
  2. 345885Class i: Low resolution protein structures [58117] (18 folds)
  3. 345886Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 345887Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 346350Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 346354Protein 50S subunit [58125] (3 species)
  7. 346364Species Deinococcus radiodurans [TaxId:1299] [69993] (13 PDB entries)
  8. 346409Domain d1ondz_: 1ond Z: [87140]
    complexed with troleandomycin macrolide antibiotic

Details for d1ondz_

PDB Entry: 1ond (more details), 3.4 Å

PDB Description: the crystal structure of the 50s large ribosomal subunit from deinococcus radiodurans complexed with troleandomycin macrolide antibiotic
PDB Compounds: (Z:)

SCOP Domain Sequences for d1ondz_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ondz_ i.1.1.2 (Z:) 50S subunit {Deinococcus radiodurans}
akhpvpkkktskskrdmrrshhaltapnltecpqchgkklshhicpncgyydgrqvla

SCOP Domain Coordinates for d1ondz_:

Click to download the PDB-style file with coordinates for d1ondz_.
(The format of our PDB-style files is described here.)

Timeline for d1ondz_: