Lineage for d1on9e2 (1on9 E:261-524)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 310547Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 310548Superfamily c.14.1: ClpP/crotonase [52096] (4 families) (S)
  5. 310667Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (2 proteins)
    the active site is formed by two different homologous subunits or domains of this fold
  6. 310680Protein Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) [89575] (1 species)
  7. 310681Species Propionibacterium freudenreichii [TaxId:1744] [89576] (2 PDB entries)
  8. 310703Domain d1on9e2: 1on9 E:261-524 [87134]

Details for d1on9e2

PDB Entry: 1on9 (more details), 2 Å

PDB Description: Transcarboxylase 12S crystal structure: hexamer assembly and substrate binding to a multienzyme core (with hydrolyzed methylmalonyl-coenzyme a bound)

SCOP Domain Sequences for d1on9e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1on9e2 c.14.1.4 (E:261-524) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii}
teeasfvnpnndvspntelrdivpidgkkgydvrdviakivdwgdylevkagyatnlvta
farvngrsvgivanqpsvmsgcldinasdkaaefvnfcdsfniplvqlvdvpgflpgvqq
eyggiirhgakmlyayseatvpkitvvlrkayggsylamcnrdlgadavyawpsaeiavm
gaegaanvifrkeikaaddpdamraekieeyqnafntpyvaaargqvddvidpadtrrki
asalemyatkrqtrpakkhgnfpc

SCOP Domain Coordinates for d1on9e2:

Click to download the PDB-style file with coordinates for d1on9e2.
(The format of our PDB-style files is described here.)

Timeline for d1on9e2: