Lineage for d1on9d1 (1on9 D:7-260)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 690605Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 690606Superfamily c.14.1: ClpP/crotonase [52096] (4 families) (S)
  5. 690933Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (6 proteins)
    Pfam PF01039
    the active site is formed by two different homologous subunits or domains of this fold
  6. 690986Protein Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) [89575] (1 species)
  7. 690987Species Propionibacterium freudenreichii [TaxId:1744] [89576] (2 PDB entries)
  8. 691006Domain d1on9d1: 1on9 D:7-260 [87131]

Details for d1on9d1

PDB Entry: 1on9 (more details), 2 Å

PDB Description: Transcarboxylase 12S crystal structure: hexamer assembly and substrate binding to a multienzyme core (with hydrolyzed methylmalonyl-coenzyme a bound)
PDB Compounds: (D:) Methylmalonyl-CoA carboxyltransferase 12S subunit

SCOP Domain Sequences for d1on9d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1on9d1 c.14.1.4 (D:7-260) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]}
lklastmegrveqlaeqrqvieagggerrvekqhsqgkqtarerlnnlldphsfdevgaf
rkhrttlfgmdkavvpadgvvtgrgtilgrpvhaasqdftvmggsagetqstkvvetmeq
alltgtpflffydsggariqegidslsgygkmffanvklsgvvpqiaiiagpcaggasys
paltdfiimtkkahmfitgpqviksvtgedvtadelggaeahmaisgnihfvaedddaae
liakkllsflpqnn

SCOP Domain Coordinates for d1on9d1:

Click to download the PDB-style file with coordinates for d1on9d1.
(The format of our PDB-style files is described here.)

Timeline for d1on9d1: