Lineage for d1on9a1 (1on9 A:9-260)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 480393Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 480394Superfamily c.14.1: ClpP/crotonase [52096] (4 families) (S)
  5. 480567Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (3 proteins)
    the active site is formed by two different homologous subunits or domains of this fold
  6. 480612Protein Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) [89575] (1 species)
  7. 480613Species Propionibacterium freudenreichii [TaxId:1744] [89576] (2 PDB entries)
  8. 480626Domain d1on9a1: 1on9 A:9-260 [87125]

Details for d1on9a1

PDB Entry: 1on9 (more details), 2 Å

PDB Description: Transcarboxylase 12S crystal structure: hexamer assembly and substrate binding to a multienzyme core (with hydrolyzed methylmalonyl-coenzyme a bound)

SCOP Domain Sequences for d1on9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1on9a1 c.14.1.4 (A:9-260) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii}
lastmegrveqlaeqrqvieagggerrvekqhsqgkqtarerlnnlldphsfdevgafrk
hrttlfgmdkavvpadgvvtgrgtilgrpvhaasqdftvmggsagetqstkvvetmeqal
ltgtpflffydsggariqegidslsgygkmffanvklsgvvpqiaiiagpcaggasyspa
ltdfiimtkkahmfitgpqviksvtgedvtadelggaeahmaisgnihfvaedddaaeli
akkllsflpqnn

SCOP Domain Coordinates for d1on9a1:

Click to download the PDB-style file with coordinates for d1on9a1.
(The format of our PDB-style files is described here.)

Timeline for d1on9a1: