SCOPe 2.05: Domain d1on7b_: 1on7 B:

Lineage for d1on7b_ (1on7 B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore
   automatically mapped to Pfam PF00502

6. Protein Phycocyanin beta subunit [88940] (8 species)

7. Species Synechococcus vulcanus [TaxId:32053] [88944] (6 PDB entries)

8. Domain d1on7b_: 1on7 B: [87122]
   Other proteins in same PDB: d1on7a_
   complexed with cyc

Details for d1on7b_

PDB Entry: 1on7, 2.7 Å

PDB Description: Unmethylated form of C-phycocyanin from Themosynechococcus vulcanus at 2.7A

PDB Compounds: (B:) c-phycocyanin beta subunit

SCOPe Domain Sequences for d1on7b_:

Sequence; same for both SEQRES and ATOM records:

>d1on7b_ a.1.1.3 (B:) Phycocyanin beta subunit {Synechococcus vulcanus [TaxId: 32053]}
mldafakvvaqadargefltnaqfdalsnlvkegnkrldavnritsnastivanaaralf
aeqpqliqpggnaytnrrmaaclrdmeiilryvtyailagdssvlddrclnglretyqal
gtpgssvavaiqkmkdaaiaiandpngitpgdcsalmseiagyfdraaaava

Timeline for d1on7b_:

• d1on7b_ first appeared in SCOP 1.65
  
• d1on7b_ appears in SCOPe 2.04
  
• d1on7b_ appears in SCOPe 2.06
  
• d1on7b_ appears in the current release, SCOPe 2.08