Lineage for d1on7a_ (1on7 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1718119Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 1718144Protein Phycocyanin alpha subunit [88933] (9 species)
  7. 1718201Species Synechococcus vulcanus [TaxId:32053] [88938] (8 PDB entries)
  8. 1718208Domain d1on7a_: 1on7 A: [87121]
    Other proteins in same PDB: d1on7b_
    complexed with cyc

Details for d1on7a_

PDB Entry: 1on7 (more details), 2.7 Å

PDB Description: Unmethylated form of C-phycocyanin from Themosynechococcus vulcanus at 2.7A
PDB Compounds: (A:) c-phycocyanin alpha subunit

SCOPe Domain Sequences for d1on7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1on7a_ a.1.1.3 (A:) Phycocyanin alpha subunit {Synechococcus vulcanus [TaxId: 32053]}
mktpiteaiaaadtqgrflsntelqavdgrfkravasmeaaraltnnaqslidgaaqavy
qkfpytttmqgsqyastpegkakcardigyylrmityclvaggtgpmdeyliaglseins
tfdlspswyiealkyikanhgltgqaaveanayidyainals

SCOPe Domain Coordinates for d1on7a_:

Click to download the PDB-style file with coordinates for d1on7a_.
(The format of our PDB-style files is described here.)

Timeline for d1on7a_: