SCOPe 2.06: Domain d1on3b1: 1on3 B:9-260

Lineage for d1on3b1 (1on3 B:9-260)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (7 proteins)
   Pfam PF01039
   the active site is formed by two different homologous subunits or domains of this fold

6. Protein Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) [89575] (1 species)

7. Species Propionibacterium freudenreichii [TaxId:1744] [89576] (2 PDB entries)

8. Domain d1on3b1: 1on3 B:9-260 [87109]
   complexed with cd, dxx, mca, mpd

Details for d1on3b1

PDB Entry: 1on3, 1.9 Å

PDB Description: Transcarboxylase 12S crystal structure: hexamer assembly and substrate binding to a multienzyme core (with methylmalonyl-coenzyme a and methylmalonic acid bound)

PDB Compounds: (B:) Methylmalonyl-CoA carboxyltransferase 12S subunit

SCOPe Domain Sequences for d1on3b1:

Sequence; same for both SEQRES and ATOM records:

>d1on3b1 c.14.1.4 (B:9-260) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]}
lastmegrveqlaeqrqvieagggerrvekqhsqgkqtarerlnnlldphsfdevgafrk
hrttlfgmdkavvpadgvvtgrgtilgrpvhaasqdftvmggsagetqstkvvetmeqal
ltgtpflffydsggariqegidslsgygkmffanvklsgvvpqiaiiagpcaggasyspa
ltdfiimtkkahmfitgpqviksvtgedvtadelggaeahmaisgnihfvaedddaaeli
akkllsflpqnn

Timeline for d1on3b1:

• d1on3b1 first appeared in SCOP 1.65
  
• d1on3b1 appears in SCOPe 2.05
  
• d1on3b1 appears in SCOPe 2.07
  
• d1on3b1 appears in the current release, SCOPe 2.08