Lineage for d1on3a2 (1on3 A:261-524)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 980706Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 980707Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 981203Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (6 proteins)
    Pfam PF01039
    the active site is formed by two different homologous subunits or domains of this fold
  6. 981256Protein Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) [89575] (1 species)
  7. 981257Species Propionibacterium freudenreichii [TaxId:1744] [89576] (2 PDB entries)
  8. 981259Domain d1on3a2: 1on3 A:261-524 [87108]
    complexed with cd, dxx, mca, mpd

Details for d1on3a2

PDB Entry: 1on3 (more details), 1.9 Å

PDB Description: Transcarboxylase 12S crystal structure: hexamer assembly and substrate binding to a multienzyme core (with methylmalonyl-coenzyme a and methylmalonic acid bound)
PDB Compounds: (A:) Methylmalonyl-CoA carboxyltransferase 12S subunit

SCOPe Domain Sequences for d1on3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1on3a2 c.14.1.4 (A:261-524) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]}
teeasfvnpnndvspntelrdivpidgkkgydvrdviakivdwgdylevkagyatnlvta
farvngrsvgivanqpsvmsgcldinasdkaaefvnfcdsfniplvqlvdvpgflpgvqq
eyggiirhgakmlyayseatvpkitvvlrkayggsylamcnrdlgadavyawpsaeiavm
gaegaanvifrkeikaaddpdamraekieeyqnafntpyvaaargqvddvidpadtrrki
asalemyatkrqtrpakkhgnfpc

SCOPe Domain Coordinates for d1on3a2:

Click to download the PDB-style file with coordinates for d1on3a2.
(The format of our PDB-style files is described here.)

Timeline for d1on3a2: