SCOP 1.65: Domain d1on2b2: 1on2 B:63-136

Lineage for d1on2b2 (1on2 B:63-136)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.76: Iron-dependent represor protein, dimerization domain [47978] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.76.1: Iron-dependent represor protein, dimerization domain [47979] (1 family)

5. Family a.76.1.1: Iron-dependent represor protein, dimerization domain [47980] (3 proteins)

6. Protein Manganese transport regulator MntR [89086] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [89087] (2 PDB entries)

8. Domain d1on2b2: 1on2 B:63-136 [87106]
   Other proteins in same PDB: d1on2a1, d1on2b1
   complexed with mn; mutant

Details for d1on2b2

PDB Entry: 1on2, 1.61 Å

PDB Description: bacillus subtilis manganese transport regulator (mntr), d8m mutant, bound to manganese

SCOP Domain Sequences for d1on2b2:

Sequence; same for both SEQRES and ATOM records:

>d1on2b2 a.76.1.1 (B:63-136) Manganese transport regulator MntR {Bacillus subtilis}
tskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfee
ddarkkdlksiqkk

Timeline for d1on2b2:

• d1on2b2 is new in SCOP 1.65
  
• d1on2b2 appears in SCOP 1.67
  
• d1on2b2 appears in the current release, SCOPe 2.08