Lineage for d1on2b2 (1on2 B:63-136)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 283291Fold a.76: Iron-dependent represor protein, dimerization domain [47978] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 283292Superfamily a.76.1: Iron-dependent represor protein, dimerization domain [47979] (1 family) (S)
  5. 283293Family a.76.1.1: Iron-dependent represor protein, dimerization domain [47980] (3 proteins)
  6. 283331Protein Manganese transport regulator MntR [89086] (1 species)
  7. 283332Species Bacillus subtilis [TaxId:1423] [89087] (2 PDB entries)
  8. 283334Domain d1on2b2: 1on2 B:63-136 [87106]
    Other proteins in same PDB: d1on2a1, d1on2b1
    complexed with mn; mutant

Details for d1on2b2

PDB Entry: 1on2 (more details), 1.61 Å

PDB Description: bacillus subtilis manganese transport regulator (mntr), d8m mutant, bound to manganese

SCOP Domain Sequences for d1on2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1on2b2 a.76.1.1 (B:63-136) Manganese transport regulator MntR {Bacillus subtilis}
tskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfee
ddarkkdlksiqkk

SCOP Domain Coordinates for d1on2b2:

Click to download the PDB-style file with coordinates for d1on2b2.
(The format of our PDB-style files is described here.)

Timeline for d1on2b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1on2b1