SCOPe 2.07: Domain d1on2b1: 1on2 B:2-62

Lineage for d1on2b1 (1on2 B:2-62)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.24: Iron-dependent repressor protein [46882] (4 proteins)
   automatically mapped to Pfam PF01325

6. Protein Manganese transport regulator MntR [88986] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [88987] (11 PDB entries)

8. Domain d1on2b1: 1on2 B:2-62 [87105]
   Other proteins in same PDB: d1on2a2, d1on2b2
   complexed with mn; mutant

Details for d1on2b1

PDB Entry: 1on2, 1.61 Å

PDB Description: bacillus subtilis manganese transport regulator (mntr), d8m mutant, bound to manganese

PDB Compounds: (B:) Transcriptional regulator mntR

SCOPe Domain Sequences for d1on2b1:

Sequence; same for both SEQRES and ATOM records:

>d1on2b1 a.4.5.24 (B:2-62) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]}
ttpsmemyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrglv
l

Timeline for d1on2b1:

• d1on2b1 first appeared in SCOP 1.65
  
• d1on2b1 appears in SCOPe 2.06
  
• d1on2b1 appears in the current release, SCOPe 2.08