Lineage for d1on2b1 (1on2 B:2-62)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1258750Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1259277Family a.4.5.24: Iron-dependent repressor protein [46882] (4 proteins)
    automatically mapped to Pfam PF01325
  6. 1259335Protein Manganese transport regulator MntR [88986] (1 species)
  7. 1259336Species Bacillus subtilis [TaxId:1423] [88987] (11 PDB entries)
  8. 1259340Domain d1on2b1: 1on2 B:2-62 [87105]
    Other proteins in same PDB: d1on2a2, d1on2b2
    complexed with mn; mutant

Details for d1on2b1

PDB Entry: 1on2 (more details), 1.61 Å

PDB Description: bacillus subtilis manganese transport regulator (mntr), d8m mutant, bound to manganese
PDB Compounds: (B:) Transcriptional regulator mntR

SCOPe Domain Sequences for d1on2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1on2b1 a.4.5.24 (B:2-62) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]}
ttpsmemyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrglv
l

SCOPe Domain Coordinates for d1on2b1:

Click to download the PDB-style file with coordinates for d1on2b1.
(The format of our PDB-style files is described here.)

Timeline for d1on2b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1on2b2