![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.24: Iron-dependent repressor protein [46882] (4 proteins) automatically mapped to Pfam PF01325 |
![]() | Protein Manganese transport regulator MntR [88986] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [88987] (11 PDB entries) |
![]() | Domain d1on2b1: 1on2 B:2-62 [87105] Other proteins in same PDB: d1on2a2, d1on2b2 complexed with mn; mutant |
PDB Entry: 1on2 (more details), 1.61 Å
SCOPe Domain Sequences for d1on2b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1on2b1 a.4.5.24 (B:2-62) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]} ttpsmemyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrglv l
Timeline for d1on2b1: