Lineage for d1on2a2 (1on2 A:63-136)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 540561Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 540562Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (1 family) (S)
  5. 540563Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (3 proteins)
  6. 540610Protein Manganese transport regulator MntR [89086] (1 species)
  7. 540611Species Bacillus subtilis [TaxId:1423] [89087] (2 PDB entries)
  8. 540612Domain d1on2a2: 1on2 A:63-136 [87104]
    Other proteins in same PDB: d1on2a1, d1on2b1

Details for d1on2a2

PDB Entry: 1on2 (more details), 1.61 Å

PDB Description: bacillus subtilis manganese transport regulator (mntr), d8m mutant, bound to manganese

SCOP Domain Sequences for d1on2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1on2a2 a.76.1.1 (A:63-136) Manganese transport regulator MntR {Bacillus subtilis}
tskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfee
ddarkkdlksiqkk

SCOP Domain Coordinates for d1on2a2:

Click to download the PDB-style file with coordinates for d1on2a2.
(The format of our PDB-style files is described here.)

Timeline for d1on2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1on2a1