Lineage for d1on2a1 (1on2 A:2-62)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 351236Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 351617Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (45 families) (S)
    contains a small beta-sheet (wing)
  5. 351919Family a.4.5.24: Iron-dependent repressor protein [46882] (3 proteins)
  6. 351957Protein Manganese transport regulator MntR [88986] (1 species)
  7. 351958Species Bacillus subtilis [TaxId:1423] [88987] (2 PDB entries)
  8. 351959Domain d1on2a1: 1on2 A:2-62 [87103]
    Other proteins in same PDB: d1on2a2, d1on2b2

Details for d1on2a1

PDB Entry: 1on2 (more details), 1.61 Å

PDB Description: bacillus subtilis manganese transport regulator (mntr), d8m mutant, bound to manganese

SCOP Domain Sequences for d1on2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1on2a1 a.4.5.24 (A:2-62) Manganese transport regulator MntR {Bacillus subtilis}
ttpsmemyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrglv
l

SCOP Domain Coordinates for d1on2a1:

Click to download the PDB-style file with coordinates for d1on2a1.
(The format of our PDB-style files is described here.)

Timeline for d1on2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1on2a2