SCOP 1.73: Domain d1on1b2: 1on1 B:63-136

Lineage for d1on1b2 (1on1 B:63-136)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (1 family)

5. Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (3 proteins)

6. Protein Manganese transport regulator MntR [89086] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [89087] (11 PDB entries)

8. Domain d1on1b2: 1on1 B:63-136 [87102]
   Other proteins in same PDB: d1on1a1, d1on1b1
   complexed with mn

Details for d1on1b2

PDB Entry: 1on1, 1.75 Å

PDB Description: Bacillus Subtilis Manganese Transport Regulator (Mntr) Bound To Manganese, AB Conformation.

PDB Compounds: (B:) Transcriptional regulator mntR

SCOP Domain Sequences for d1on1b2:

Sequence; same for both SEQRES and ATOM records:

>d1on1b2 a.76.1.1 (B:63-136) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]}
tskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfee
ddarkkdlksiqkk

Timeline for d1on1b2:

• d1on1b2 first appeared in SCOP 1.65
  
• d1on1b2 appears in SCOP 1.71
  
• d1on1b2 appears in SCOP 1.75
  
• d1on1b2 appears in the current release, SCOPe 2.08