Class a: All alpha proteins [46456] (226 folds) |
Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily) 6 helices, homodimer of 3-helical domains |
Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (1 family) |
Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (3 proteins) |
Protein Manganese transport regulator MntR [89086] (1 species) |
Species Bacillus subtilis [TaxId:1423] [89087] (2 PDB entries) |
Domain d1on1a2: 1on1 A:63-136 [87100] Other proteins in same PDB: d1on1a1, d1on1b1 |
PDB Entry: 1on1 (more details), 1.75 Å
SCOP Domain Sequences for d1on1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1on1a2 a.76.1.1 (A:63-136) Manganese transport regulator MntR {Bacillus subtilis} tskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfee ddarkkdlksiqkk
Timeline for d1on1a2: