SCOP 1.69: Domain d1on0d_: 1on0 D:

Lineage for d1on0d_ (1on0 D:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (5 families)

5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (20 proteins)

6. Protein Putative acetyltransferase YycN [90011] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [90012] (2 PDB entries)

8. Domain d1on0d_: 1on0 D: [87098]
   structural genomics; target SR144

Details for d1on0d_

PDB Entry: 1on0, 2.2 Å

PDB Description: crystal structure of putative acetyltransferase (yycn) from bacillus subtilis, northeast structural genomics consortium target sr144

SCOP Domain Sequences for d1on0d_:

Sequence; same for both SEQRES and ATOM records:

>d1on0d_ d.108.1.1 (D:) Putative acetyltransferase YycN {Bacillus subtilis}
timltpmqteefrsyltyttkhyaeekvkagtwlpedaqllskqvftdllprgletphhh
lwslklnekdivgwlwihaepehpqqeafiydfglyepyrgkgyakqalaaldqaarsmg
irklslhvfahnqtarklyeqtgfqetdvvmskklle

Timeline for d1on0d_:

• d1on0d_ first appeared in SCOP 1.65
  
• d1on0d_ appears in SCOP 1.67
  
• d1on0d_ appears in SCOP 1.71
  
• d1on0d_ appears in the current release, SCOPe 2.08, called d1on0d1