Lineage for d1omxb_ (1omx B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133845Family c.68.1.15: Exostosin [89760] (1 protein)
    automatically mapped to Pfam PF09258
  6. 2133846Protein Alpha-1,4-N-acetylhexosaminyltransferase (Alpha-GalNAcT EXTL2) [89761] (1 species)
  7. 2133847Species Mouse (Mus musculus) [TaxId:10090] [89762] (4 PDB entries)
  8. 2133853Domain d1omxb_: 1omx B: [87092]
    complexed with edo

Details for d1omxb_

PDB Entry: 1omx (more details), 2.4 Å

PDB Description: crystal structure of mouse alpha-1,4-n-acetylhexosaminyltransferase (extl2)
PDB Compounds: (B:) Alpha-1,4-N-acetylhexosaminyltransferase EXTL2

SCOPe Domain Sequences for d1omxb_:

Sequence, based on SEQRES records: (download)

>d1omxb_ c.68.1.15 (B:) Alpha-1,4-N-acetylhexosaminyltransferase (Alpha-GalNAcT EXTL2) {Mouse (Mus musculus) [TaxId: 10090]}
aldsftlimqtynrtdlllrllnhyqavpslhkvivvwnnvgekgpeelwnslgphpipv
ifkpqtankmrnrlqvfpevetnavlmvdddtlisaqdlvfafsiwqqfpdqiigfvprk
hvstssgiysyggfelqtpgpgngdqysmvligasffnskylelfqkqpaavhalidetq
ncddiamnflvtrhtgkpsgifvkpinmvnleketngysgmwhraehflqrsycinklvn
iydgmplkysnimisqfgfpyanhk

Sequence, based on observed residues (ATOM records): (download)

>d1omxb_ c.68.1.15 (B:) Alpha-1,4-N-acetylhexosaminyltransferase (Alpha-GalNAcT EXTL2) {Mouse (Mus musculus) [TaxId: 10090]}
aldsftlimqtynrtdlllrllnhyqavpslhkvivvwnnvgekgpeelwnslgphpipv
ifkpqtankmrnrlqvfpevetnavlmvdddtlisaqdlvfafsiwqqfpdqiigfvprk
hvstssgiysyggfelqtpgpgngdqysmvligasffnskylelfqkqpaavhalidetq
ncddiamnflvtrhtgkpsgifvkpinmvnlehflqrsycinklvniydgmplkysnimi
sqfgfpyanhk

SCOPe Domain Coordinates for d1omxb_:

Click to download the PDB-style file with coordinates for d1omxb_.
(The format of our PDB-style files is described here.)

Timeline for d1omxb_: