SCOPe 2.03: Domain d1omwa1: 1omw A:29-185

Lineage for d1omwa1 (1omw A:29-185)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
   multihelical; consists of two all-alpha subdomains
   contains a 4-helical bundle with left-handed twist and up-and-down topology

4. Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families)

5. Family a.91.1.1: Regulator of G-protein signaling, RGS [48098] (10 proteins)

6. Protein G-protein coupled receptor kinase 2, N-terminal domain [89090] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [89091] (3 PDB entries)

8. Domain d1omwa1: 1omw A:29-185 [87086]
   Other proteins in same PDB: d1omwa2, d1omwa3, d1omwb_, d1omwg_

Details for d1omwa1

PDB Entry: 1omw, 2.5 Å

PDB Description: crystal structure of the complex between g protein-coupled receptor kinase 2 and heterotrimeric g protein beta 1 and gamma 2 subunits

PDB Compounds: (A:) g-protein coupled receptor kinase 2

SCOPe Domain Sequences for d1omwa1:

Sequence; same for both SEQRES and ATOM records:

>d1omwa1 a.91.1.1 (A:29-185) G-protein coupled receptor kinase 2, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
skkillpepsirsvmqkyledrgevtfekifsqklgyllfrdfclkhleeakplvefyee
ikkyekleteeerlvcsreifdtyimkellacshpfsksaiehvqghlvkkqvppdlfqp
yieeicqnlrgdvfqkfiesdkftrfcqwknvelnih

Timeline for d1omwa1:

• d1omwa1 first appeared in SCOP 1.65
  
• d1omwa1 appears in SCOPe 2.02
  
• d1omwa1 appears in SCOPe 2.04
  
• d1omwa1 appears in the current release, SCOPe 2.08