Class b: All beta proteins [48724] (141 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.3: cAMP-binding domain-like [51206] (3 families) |
Family b.82.3.3: Listeriolysin regulatory protein PrfA, N-terminal domain [89419] (1 protein) |
Protein Listeriolysin regulatory protein PrfA, N-terminal domain [89420] (1 species) |
Species Bacteria (Listeria monocytogenes) [TaxId:1639] [89421] (1 PDB entry) |
Domain d1omib1: 1omi B:2005-2137 [87081] Other proteins in same PDB: d1omia2, d1omib2 complexed with gol |
PDB Entry: 1omi (more details), 2.8 Å
SCOP Domain Sequences for d1omib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1omib1 b.82.3.3 (B:2005-2137) Listeriolysin regulatory protein PrfA, N-terminal domain {Bacteria (Listeria monocytogenes)} gsefkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimnlqyyk gafvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqtlqkqv syslakfndfsin
Timeline for d1omib1: