![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) ![]() |
![]() | Family b.82.3.3: Listeriolysin regulatory protein PrfA, N-terminal domain [89419] (2 proteins) |
![]() | Protein Listeriolysin regulatory protein PrfA, N-terminal domain [89420] (1 species) |
![]() | Species Listeria monocytogenes [TaxId:1639] [89421] (1 PDB entry) |
![]() | Domain d1omib1: 1omi B:2007-2137 [87081] Other proteins in same PDB: d1omia2, d1omia3, d1omib2, d1omib3 complexed with gol |
PDB Entry: 1omi (more details), 2.8 Å
SCOPe Domain Sequences for d1omib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1omib1 b.82.3.3 (B:2007-2137) Listeriolysin regulatory protein PrfA, N-terminal domain {Listeria monocytogenes [TaxId: 1639]} efkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimnlqyykga fvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqtlqkqvsy slakfndfsin
Timeline for d1omib1: