Lineage for d1omib1 (1omi B:2007-2137)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2816658Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 2816885Family b.82.3.3: Listeriolysin regulatory protein PrfA, N-terminal domain [89419] (2 proteins)
  6. 2816886Protein Listeriolysin regulatory protein PrfA, N-terminal domain [89420] (1 species)
  7. 2816887Species Listeria monocytogenes [TaxId:1639] [89421] (1 PDB entry)
  8. 2816889Domain d1omib1: 1omi B:2007-2137 [87081]
    Other proteins in same PDB: d1omia2, d1omia3, d1omib2, d1omib3
    complexed with gol

Details for d1omib1

PDB Entry: 1omi (more details), 2.8 Å

PDB Description: crystal structure of prfa,the transcriptional regulator in listeria monocytogenes
PDB Compounds: (B:) listeriolysin regulatory protein

SCOPe Domain Sequences for d1omib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1omib1 b.82.3.3 (B:2007-2137) Listeriolysin regulatory protein PrfA, N-terminal domain {Listeria monocytogenes [TaxId: 1639]}
efkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimnlqyykga
fvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqtlqkqvsy
slakfndfsin

SCOPe Domain Coordinates for d1omib1:

Click to download the PDB-style file with coordinates for d1omib1.
(The format of our PDB-style files is described here.)

Timeline for d1omib1: