Lineage for d1omia2 (1omi A:1138-1237)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1982239Family a.4.5.4: CAP C-terminal domain-like [46796] (9 protein domains)
  6. Protein Listeriolysin regulatory protein PrfA, C-terminal domain [88975] (1 species)
  7. Species Listeria monocytogenes [TaxId:1639] [88976] (1 PDB entry)
  8. 1982323Domain d1omia2: 1omi A:1138-1237 [87080]
    Other proteins in same PDB: d1omia1, d1omia3, d1omib1, d1omib3
    complexed with gol

Details for d1omia2

PDB Entry: 1omi (more details), 2.8 Å

PDB Description: Crystal structure of PrfA,the transcriptional regulator in Listeria monocytogenes
PDB Compounds: (A:) listeriolysin regulatory protein

SCOPe Domain Sequences for d1omia2:

Sequence, based on SEQRES records: (download)

>d1omia2 a.4.5.4 (A:1138-1237) Listeriolysin regulatory protein PrfA, C-terminal domain {Listeria monocytogenes [TaxId: 1639]}
gklgsicgqlliltyvygketpdgikitldnltmqelgyssgiahssavsriisklkqek
vivyknscfyvqnldylkryapkldewfylacpatwgkln

Sequence, based on observed residues (ATOM records): (download)

>d1omia2 a.4.5.4 (A:1138-1237) Listeriolysin regulatory protein PrfA, C-terminal domain {Listeria monocytogenes [TaxId: 1639]}
gklgsicgqlliltyvygketpdgikitldnltmqelsavsriisklkqekvivyknscf
yvqnldylkryapkldewfylacpatwgkln

SCOPe Domain Coordinates for d1omia2:

Click to download the PDB-style file with coordinates for d1omia2.
(The format of our PDB-style files is described here.)

Timeline for d1omia2: