Lineage for d1om9b_ (1om9 B:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 455905Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (3 families) (S)
    contains an additional N-terminal strand
  5. 455921Family b.1.10.2: gamma-adaptin C-terminal appendage domain-like [74857] (3 proteins)
    consist of a single subdomain
  6. 455922Protein ADP-ribosylation factor binding protein Gga1 domain [89201] (1 species)
  7. 455923Species Human (Homo sapiens) [TaxId:9606] [89202] (2 PDB entries)
  8. 455927Domain d1om9b_: 1om9 B: [87078]
    complexed with the p56 binding peptide; chains P and Q

Details for d1om9b_

PDB Entry: 1om9 (more details), 2.5 Å

PDB Description: Structure of the GGA1-appendage in complex with the p56 binding peptide

SCOP Domain Sequences for d1om9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1om9b_ b.1.10.2 (B:) ADP-ribosylation factor binding protein Gga1 domain {Human (Homo sapiens)}
asitvplesikpsnilpvtvydqhgfrilfhfardplpgrsdvlvvvvsmlstapqpirn
ivfqsavpkvmkvklqppsgtelpafnpivhpsaitqvlllanpqkekvrlrykltftmg
dqtynemgdvdqfpppetwgsl

SCOP Domain Coordinates for d1om9b_:

Click to download the PDB-style file with coordinates for d1om9b_.
(The format of our PDB-style files is described here.)

Timeline for d1om9b_: