![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (4 families) ![]() contains an additional N-terminal strand |
![]() | Family b.1.10.2: gamma-adaptin C-terminal appendage domain-like [74857] (4 proteins) consist of a single subdomain automatically mapped to Pfam PF02883 |
![]() | Protein ADP-ribosylation factor binding protein Gga1 domain [89201] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [89202] (2 PDB entries) |
![]() | Domain d1om9b_: 1om9 B: [87078] complexed with the p56 binding peptide; chains P and Q |
PDB Entry: 1om9 (more details), 2.5 Å
SCOPe Domain Sequences for d1om9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1om9b_ b.1.10.2 (B:) ADP-ribosylation factor binding protein Gga1 domain {Human (Homo sapiens) [TaxId: 9606]} asitvplesikpsnilpvtvydqhgfrilfhfardplpgrsdvlvvvvsmlstapqpirn ivfqsavpkvmkvklqppsgtelpafnpivhpsaitqvlllanpqkekvrlrykltftmg dqtynemgdvdqfpppetwgsl
Timeline for d1om9b_: