SCOPe 2.08: Domain d1om9b_: 1om9 B:

Lineage for d1om9b_ (1om9 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (4 families)
   contains an additional N-terminal strand

5. Family b.1.10.2: gamma-adaptin C-terminal appendage domain-like [74857] (4 proteins)
   consist of a single subdomain
   automatically mapped to Pfam PF02883

6. Protein ADP-ribosylation factor binding protein Gga1 domain [89201] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89202] (2 PDB entries)

8. Domain d1om9b_: 1om9 B: [87078]
   complexed with the p56 binding peptide; chains P and Q

Details for d1om9b_

PDB Entry: 1om9, 2.5 Å

PDB Description: Structure of the GGA1-appendage in complex with the p56 binding peptide

PDB Compounds: (B:) ADP-ribosylation factor binding protein GGA1

SCOPe Domain Sequences for d1om9b_:

Sequence; same for both SEQRES and ATOM records:

>d1om9b_ b.1.10.2 (B:) ADP-ribosylation factor binding protein Gga1 domain {Human (Homo sapiens) [TaxId: 9606]}
asitvplesikpsnilpvtvydqhgfrilfhfardplpgrsdvlvvvvsmlstapqpirn
ivfqsavpkvmkvklqppsgtelpafnpivhpsaitqvlllanpqkekvrlrykltftmg
dqtynemgdvdqfpppetwgsl

Timeline for d1om9b_:

• d1om9b_ first appeared in SCOP 1.65
  
• d1om9b_ appears in SCOPe 2.07