![]() | Class b: All beta proteins [48724] (144 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (3 families) ![]() contains an additional N-terminal strand |
![]() | Family b.1.10.2: gamma-adaptin C-terminal appendage domain-like [74857] (3 proteins) consist of a single subdomain |
![]() | Protein ADP-ribosylation factor binding protein Gga1 domain [89201] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [89202] (2 PDB entries) |
![]() | Domain d1om9a_: 1om9 A: [87077] |
PDB Entry: 1om9 (more details), 2.5 Å
SCOP Domain Sequences for d1om9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1om9a_ b.1.10.2 (A:) ADP-ribosylation factor binding protein Gga1 domain {Human (Homo sapiens)} asitvplesikpsnilpvtvydqhgfrilfhfardplpgrsdvlvvvvsmlstapqpirn ivfqsavpkvmkvklqppsgtelpafnpivhpsaitqvlllanpqkekvrlrykltftmg dqtynemgdvdqfpppetwgsl
Timeline for d1om9a_: