SCOP 1.67: Domain d1om9a_: 1om9 A:

Lineage for d1om9a_ (1om9 A:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (3 families)
   contains an additional N-terminal strand

5. Family b.1.10.2: gamma-adaptin C-terminal appendage domain-like [74857] (3 proteins)
   consist of a single subdomain

6. Protein ADP-ribosylation factor binding protein Gga1 domain [89201] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89202] (2 PDB entries)

8. Domain d1om9a_: 1om9 A: [87077]

Details for d1om9a_

PDB Entry: 1om9, 2.5 Å

PDB Description: Structure of the GGA1-appendage in complex with the p56 binding peptide

SCOP Domain Sequences for d1om9a_:

Sequence; same for both SEQRES and ATOM records:

>d1om9a_ b.1.10.2 (A:) ADP-ribosylation factor binding protein Gga1 domain {Human (Homo sapiens)}
asitvplesikpsnilpvtvydqhgfrilfhfardplpgrsdvlvvvvsmlstapqpirn
ivfqsavpkvmkvklqppsgtelpafnpivhpsaitqvlllanpqkekvrlrykltftmg
dqtynemgdvdqfpppetwgsl

Timeline for d1om9a_:

• d1om9a_ first appeared in SCOP 1.65
  
• d1om9a_ appears in SCOP 1.69
  
• d1om9a_ appears in the current release, SCOPe 2.08