Class b: All beta proteins [48724] (176 folds) |
Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.80.7: beta-Roll [51120] (2 families) superhelix turns are made of two short strands each |
Family b.80.7.1: Serralysin-like metalloprotease, C-terminal domain [51121] (1 protein) duplication: halfturs of beta-helix are sequence and structural repeats; binds calcium ions between the turns this is a repeat family; one repeat unit is 1go7 P:374-356 found in domain |
Protein Metalloprotease [51122] (4 species) The catalytic N-terminal domain belong to the "zincin" superfamily |
Species Pseudomonas sp., tac ii 18 [TaxId:306] [82190] (8 PDB entries) psychrophilic alkaline protease |
Domain d1om7a1: 1om7 A:245-463 [87073] Other proteins in same PDB: d1om7a2 complexed with ca, so4 |
PDB Entry: 1om7 (more details), 2.8 Å
SCOPe Domain Sequences for d1om7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1om7a1 b.80.7.1 (A:245-463) Metalloprotease {Pseudomonas sp., tac ii 18 [TaxId: 306]} anletraddtvygfnstadrdfysatsstdklifsvwdgggndtldfsgfsqnqkinlta gsfsdvggmtgnvsiaqgvtienaiggsgndlligndaanvlkggagndiiyggggadvl wggtgsdtfvfgavsdstpkaadiikdfqsgfdkidltaitklgglnfvdaftghagdai vsyhqasnagslqvdfsgqgvadflvttvgqvatydiva
Timeline for d1om7a1: