Lineage for d1om3k1 (1om3 K:1-115)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1510447Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1510451Species Engineered (including hybrid species) [88562] (68 PDB entries)
    SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # humanized antibody ! SQ NA # Humanized antibody ! SQ NA # engineered antibody
  8. 1510482Domain d1om3k1: 1om3 K:1-115 [87061]
    Other proteins in same PDB: d1om3h2, d1om3k2, d1om3l1, d1om3l2, d1om3m1, d1om3m2
    part of engineered Fab 2G12

Details for d1om3k1

PDB Entry: 1om3 (more details), 2.2 Å

PDB Description: fab 2g12 unliganded
PDB Compounds: (K:) FAB 2G12, heavy chain

SCOPe Domain Sequences for d1om3k1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1om3k1 b.1.1.1 (K:1-115) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
evqlvesggglvkaggslilscgvsnfrisahtmnwvrrvpggglewvasistsstyrdy
adavkgrftvsrddledfvylqmhkmrvedtaiyycarkgsdrlsdndpfdawgpgtvvt
vspas

SCOPe Domain Coordinates for d1om3k1:

Click to download the PDB-style file with coordinates for d1om3k1.
(The format of our PDB-style files is described here.)

Timeline for d1om3k1: