Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.5: Type II chitinase [51534] (15 proteins) glycosylase family 18 |
Protein Xylanase inhibitor protein I, XIP-I [89478] (1 species) |
Species Wheat (Triticum aestivum) [TaxId:4565] [89479] (3 PDB entries) Uniprot Q8L5C6 |
Domain d1om0a_: 1om0 A: [87058] complexed with edo, nag, ndg |
PDB Entry: 1om0 (more details), 1.8 Å
SCOPe Domain Sequences for d1om0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1om0a_ c.1.8.5 (A:) Xylanase inhibitor protein I, XIP-I {Wheat (Triticum aestivum) [TaxId: 4565]} aggktgqvtvfwgrnkaegslreacdsgmytmvtmsfldvfgangkyhldlsghdlssvg adikhcqskgvpvslsiggygtgyslpsnrsaldlfdhlwnsyfggskpsvprpfgdawl dgvdlflehgtpadrydvlalelakhnirggpgkplhltatvrcgyppaahvgralatgi fervhvrtyesdkwcnqnlgwegswdkwtaaypatrfyvgltaddkshqwvhpknvyygv apvaqkkdnyggimlwdryfdkqtnysslikyya
Timeline for d1om0a_: