Lineage for d1om0a_ (1om0 A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 305036Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 305661Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 306351Family c.1.8.5: Type II chitinase [51534] (14 proteins)
    glycosylase family 18
  6. 306461Protein Xylanase inhibitor protein I, XIP-I [89478] (1 species)
  7. 306462Species Wheat (Triticum aestivum) [TaxId:4565] [89479] (1 PDB entry)
  8. 306463Domain d1om0a_: 1om0 A: [87058]
    complexed with egl, nag

Details for d1om0a_

PDB Entry: 1om0 (more details), 1.8 Å

PDB Description: crystal structure of xylanase inhibitor protein (xip-i) from wheat

SCOP Domain Sequences for d1om0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1om0a_ c.1.8.5 (A:) Xylanase inhibitor protein I, XIP-I {Wheat (Triticum aestivum)}
aggktgqvtvfwgrnkaegslreacdsgmytmvtmsfldvfgangkyhldlsghdlssvg
adikhcqskgvpvslsiggygtgyslpsnrsaldlfdhlwnsyfggskpsvprpfgdawl
dgvdlflehgtpadrydvlalelakhnirggpgkplhltatvrcgyppaahvgralatgi
fervhvrtyesdkwcnqnlgwegswdkwtaaypatrfyvgltaddkshqwvhpknvyygv
apvaqkkdnyggimlwdryfdkqtnysslikyya

SCOP Domain Coordinates for d1om0a_:

Click to download the PDB-style file with coordinates for d1om0a_.
(The format of our PDB-style files is described here.)

Timeline for d1om0a_: