Lineage for d1oiab_ (1oia B:)
- Root: SCOP 1.67
Class d: Alpha and beta proteins (a+b) [53931] (260 folds) 
Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) 
Family d.58.7.1: Canonical RBD [54929] (20 proteins) 
Protein Splicesomal U1A protein [54932] (1 species)
duplication: contains two domains of this foldSpecies Human (Homo sapiens) [TaxId:9606] [54933] (13 PDB entries) 
Domain d1oiab_: 1oia B: [87052]
Details for d1oiab_
PDB Entry: 1oia (more details), 2.4 Å
PDB Description: u1a rnp domain 1-95
SCOP Domain Sequences for d1oiab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oiab_ d.58.7.1 (B:) Splicesomal U1A protein {Human (Homo sapiens)}
trpnhtiyinnlnekikkdelkkslyaifsqfgqildilvsrslkmrgqafvifkevssa
tnalrsmqgfpfydkpmriqyaktds
SCOP Domain Coordinates for d1oiab_:
Click to download the PDB-style file with coordinates for d1oiab_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1oiab_:
- d1oiab_ first appeared in SCOP 1.65
- d1oiab_ appears in SCOP 1.69
- d1oiab_ appears in the current release, SCOPe 2.08
View in 3D
